Overview

  • Product name
    Anti-JMJD8 antibody
  • Description
    Rabbit polyclonal to JMJD8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human JMJD8 aa 169-209 (internal sequence). The exact sequence is proprietary.
    Sequence:

    FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN


    Database link: Q96S16

  • Positive control
    • WB: Jurkat cell lysate. IHC-P: Human skeletal muscle tissue slide.

Properties

Applications

Our Abpromise guarantee covers the use of ab22843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Detects a band of approximately 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

Images

  • ab22843 staining human muscle tissue sections by IHC-P. The primary antibody was diluted 4 µg/ml. Arrows indicate positively labelled skeletal muscle cells.

  • Anti-JMJD8 antibody (ab22843) at 0.5 µg/ml + Jurkat cell lysate

    Secondary
    HRP conjugated anti rabbit IgG

References

ab22843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab22843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up