Overview

  • Product name

  • Description

    Rabbit polyclonal to JNK2
  • Host species

    Rabbit
  • Specificity

    There is a 71% chance that this antibody will cross-react with JNK3 if in the same tissue.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human JNK2 aa 340-390 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    AQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQ S


    Database link: P45984

  • Positive control

    • Human skin and rat brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells.
    JNK2 isoforms display different binding patterns: alpha-1 and alpha-2 preferentially bind to c-Jun, whereas beta-1 and beta-2 bind to ATF2. However, there is no correlation between binding and phosphorylation, which is achieved at about the same efficiency by all isoforms. JUNB is not a substrate for JNK2 alpha-2, and JUND binds only weakly to it.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-183 and Tyr-185, which activates the enzyme. Autophosphorylated in vitro.
  • Information by UniProt
  • Database links

  • Alternative names

    • c Jun kinase 2 antibody
    • C Jun N terminal kinase 2 antibody
    • c-Jun N-terminal kinase 2 antibody
    • JNK 55 antibody
    • JNK-55 antibody
    • JNK2 alpha antibody
    • JNK2 antibody
    • JNK2 beta antibody
    • JNK2A antibody
    • JNK2alpha antibody
    • JNK2B antibody
    • JNK2BETA antibody
    • Jun kinase antibody
    • MAP kinase 9 antibody
    • MAPK 9 antibody
    • Mapk9 antibody
    • Mitogen activated protein kinase 9 antibody
    • Mitogen-activated protein kinase 9 antibody
    • MK09_HUMAN antibody
    • P54a antibody
    • p54aSAPK antibody
    • PRKM9 antibody
    • Protein kinase, mitogen-activated, 9 antibody
    • SAPK alpha antibody
    • SAPK antibody
    • SAPK1a antibody
    • Stress activated protein kinase 1a antibody
    • Stress-activated protein kinase JNK2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue, labeling JNK2 with ab217688 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue, labeling JNK2 with ab217688 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue, labeling JNK2 with ab217688 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up