Anti-JP-1 antibody (ab195312)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-JP-1 antibody
See all JP-1 primary antibodies -
Description
Rabbit polyclonal to JP-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Opossum, Elephant
-
Immunogen
Synthetic peptide within Human JP-1 aa 450-500 (internal sequence). The exact sequence is proprietary.
Sequence:KESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKR S
Database link: Q9HDC5 -
Positive control
- HeLa and 293T cell lysates.
-
General notes
Previously labelled as JPH1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab195312 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000 - 1/10000. Predicted molecular weight: 72 kDa. | |
| IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels. JPH1 contributes to the construction of the skeletal muscle triad by linking the t-tubule (transverse-tubule) and SR (sarcoplasmic reticulum) membranes. -
Tissue specificity
Abundantly expressed in skeletal muscle. Very low levels in heart. -
Sequence similarities
Belongs to the junctophilin family.
Contains 7 MORN repeats. -
Domain
The MORN (membrane occupation and recognition nexus) repeats contribute to the plasma membrane binding, possibly by interacting with phospholipids. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane. Localized predominantly on the plasma membrane. The transmembrane domain is anchored in endoplasmic/sarcoplasmic reticulum membrane, while the N-terminal part associates with the plasma membrane. In skeletal muscle cells, it is predominantly localized at the junction of the A and I bands. - Information by UniProt
-
Database links
- Entrez Gene: 56704 Human
- Omim: 605266 Human
- SwissProt: Q9HDC5 Human
- Unigene: 657367 Human
-
Alternative names
- DKFZp762L0313 antibody
- JP 1 antibody
- JP-1 antibody
see all
Images
-
Immunoprecipitation - Anti-JP-1 antibody (ab195312)Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using RIPA lysis buffer. Antibodies: ab195312 used for IP at 6 µg per reaction. For blotting immunoprecipitated Junctophilin 1, ab195312 was used at 1 µg/mL.
-
Western blot - Anti-JP-1 antibody (ab195312)All lanes : Anti-JP-1 antibody (ab195312) at 0.1 µg/ml
Lane 1 : HeLa cell lysate
Lane 2 : 293T cell lysate
Lane 3 : Jurkat cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 72 kDa
Exposure time: 3 minutes
Datasheets and documents
References
ab195312 has not yet been referenced specifically in any publications.
