Anti-JP-1 antibody (ab195312)
Key features and details
- Rabbit polyclonal to JP-1
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-JP-1 antibody
See all JP-1 primary antibodies -
Description
Rabbit polyclonal to JP-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Opossum, Elephant -
Immunogen
Synthetic peptide within Human JP-1 aa 450-500 (internal sequence). The exact sequence is proprietary.
Sequence:KESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKR S
Database link: Q9HDC5 -
Positive control
- HeLa and 293T cell lysates.
-
General notes
Previously labelled as JPH1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab195312 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 72 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels. JPH1 contributes to the construction of the skeletal muscle triad by linking the t-tubule (transverse-tubule) and SR (sarcoplasmic reticulum) membranes. -
Tissue specificity
Abundantly expressed in skeletal muscle. Very low levels in heart. -
Sequence similarities
Belongs to the junctophilin family.
Contains 7 MORN repeats. -
Domain
The MORN (membrane occupation and recognition nexus) repeats contribute to the plasma membrane binding, possibly by interacting with phospholipids. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane. Localized predominantly on the plasma membrane. The transmembrane domain is anchored in endoplasmic/sarcoplasmic reticulum membrane, while the N-terminal part associates with the plasma membrane. In skeletal muscle cells, it is predominantly localized at the junction of the A and I bands. - Information by UniProt
-
Database links
- Entrez Gene: 56704 Human
- Omim: 605266 Human
- SwissProt: Q9HDC5 Human
- Unigene: 657367 Human
-
Alternative names
- DKFZp762L0313 antibody
- JP 1 antibody
- JP-1 antibody
see all
Images
-
Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using RIPA lysis buffer. Antibodies: ab195312 used for IP at 6 µg per reaction. For blotting immunoprecipitated Junctophilin 1, ab195312 was used at 1 µg/mL.
-
All lanes : Anti-JP-1 antibody (ab195312) at 0.1 µg/ml
Lane 1 : HeLa cell lysate
Lane 2 : 293T cell lysate
Lane 3 : Jurkat cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 72 kDa
Exposure time: 3 minutes
Protocols
Datasheets and documents
References (0)
ab195312 has not yet been referenced specifically in any publications.