Anti-Junctional Adhesion Molecule 1/JAM-A antibody (ab180821)
Key features and details
- Rabbit polyclonal to Junctional Adhesion Molecule 1/JAM-A
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Junctional Adhesion Molecule 1/JAM-A antibody
See all Junctional Adhesion Molecule 1/JAM-A primary antibodies -
Description
Rabbit polyclonal to Junctional Adhesion Molecule 1/JAM-A -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Junctional Adhesion Molecule 1/JAM-A aa 30-238. Extracellular domain.
Sequence:TVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKI TASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL VPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKS TRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRM EAVERNVGV
Database link: Q9Y624 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180821 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
|
|
ICC/IF |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa. |
ICC/IF
Use at an assay dependent concentration. |
Target
-
Function
Seems to plays a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly (By similarity). Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation. In case of orthoreovirus infection, serves as receptor for the virus. -
Sequence similarities
Belongs to the immunoglobulin superfamily.
Contains 2 Ig-like V-type (immunoglobulin-like) domains. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Cell junction > tight junction. Cell membrane. Localized at tight junctions of both epithelial and endothelial cells. - Information by UniProt
-
Database links
- Entrez Gene: 50848 Human
- Omim: 605721 Human
- SwissProt: Q9Y624 Human
- Unigene: 517293 Human
-
Alternative names
- CD 321 antibody
- CD321 antibody
- CD321 antigen antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (14)
ab180821 has been referenced in 14 publications.
- Wei CX et al. Lactobacillus plantarum improves LPS-induced Caco2 cell line intestinal barrier damage via cyclic AMP-PKA signaling. PLoS One 17:e0267831 (2022). PubMed: 35639684
- Xie YY et al. The protective effects of hyperoside on Ang II-mediated apoptosis of bEnd.3 cells and injury of blood-brain barrier model in vitro. BMC Complement Med Ther 22:157 (2022). PubMed: 35698113
- Wu M et al. JAM-A facilitates hair follicle regeneration in alopecia areata through functioning as ceRNA to protect VCAN expression in dermal papilla cells. Precis Clin Med 5:pbac020 (2022). PubMed: 36132055
- Huang J et al. Methamphetamine and HIV-Tat Protein Synergistically Induce Oxidative Stress and Blood-Brain Barrier Damage via Transient Receptor Potential Melastatin 2 Channel. Front Pharmacol 12:619436 (2021). PubMed: 33815104
- Wang Q et al. Activation of the G Protein-Coupled Estrogen Receptor Prevented the Development of Acute Colitis by Protecting the Crypt Cell. J Pharmacol Exp Ther 376:281-293 (2021). PubMed: 33318078