Anti-Junctional Adhesion Molecule 1/JAM-A antibody (ab180821)

Overview

  • Product name

    Anti-Junctional Adhesion Molecule 1/JAM-A antibody
    See all Junctional Adhesion Molecule 1/JAM-A primary antibodies
  • Description

    Rabbit polyclonal to Junctional Adhesion Molecule 1/JAM-A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Junctional Adhesion Molecule 1/JAM-A aa 30-238. Extracellular domain.
    Sequence:

    TVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKI TASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVL VPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKS TRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRM EAVERNVGV


    Database link: Q9Y624

  • Positive control

    • Recombinant Human Junctional Adhesion Molecule 1/JAM-A protein (ab132180) can be used as a positive control in WB. HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab180821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Seems to plays a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly (By similarity). Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation. In case of orthoreovirus infection, serves as receptor for the virus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell junction > tight junction. Cell membrane. Localized at tight junctions of both epithelial and endothelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 321 antibody
    • CD321 antibody
    • CD321 antigen antibody
    • ESTM33 antibody
    • F11 receptor antibody
    • F11R antibody
    • JAM 1 antibody
    • JAM A antibody
    • JAM antibody
    • JAM-1 antibody
    • JAM-A antibody
    • JAM1 antibody
    • JAM1_HUMAN antibody
    • JAMA antibody
    • JCAM antibody
    • Jcam1 antibody
    • Junction adhesion molecule 1 antibody
    • Junction adhesion molecule, mouse, homolog of antibody
    • Junctional adhesion molecule 1 antibody
    • Junctional adhesion molecule A antibody
    • KAT antibody
    • Ly106 antibody
    • PAM 1 antibody
    • PAM-1 antibody
    • PAM1 antibody
    • Platelet adhesion molecule 1 antibody
    • Platelet adhesion molecule antibody
    • Platelet F11 receptor antibody
    • PRO301 antibody
    • UNQ264 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab180821. Blue DAPI for nuclear staining.
  • Anti-Junctional Adhesion Molecule 1/JAM-A antibody (ab180821) at 1/500 dilution + HeLa cell lysate

    Predicted band size: 32 kDa

References

This product has been referenced in:

  • Ma X  et al. Activation of GABAA Receptors in Colon Epithelium Exacerbates Acute Colitis. Front Immunol 9:987 (2018). Read more (PubMed: 29867964) »
  • Wu KZ  et al. Junctional adhesion molecule A: expression in the murine epididymal tract and accessory organs and acquisition by maturing sperm. Mol Hum Reprod 23:132-140 (2017). Read more (PubMed: 28062807) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rhesus monkey Tissue sections (Jejunum)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: high pH buffer followed by low pH citrate buffer
Permeabilization
Yes - 0.1% Triton-X-100
Specification
Jejunum
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Z-FIX

Abcam user community

Verified customer

Submitted Feb 19 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (vessel)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate buffer
Permeabilization
No
Specification
vessel
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
10% Formalin

Abcam user community

Verified customer

Submitted Dec 11 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Bos taurus Cell (Bovine retinal endothelial cells, p4)
Permeabilization
Yes - Triton X-100 (0.25%)
Specification
Bovine retinal endothelial cells, p4
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
Paraformaldehyde

Dr. Sean Shaw

Verified customer

Submitted Mar 22 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up