Overview

  • Product name

    Anti-K28 antibody
  • Description

    Rabbit polyclonal to K28
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse K28 aa 1-462. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    MSLRFSGGSRHVGIQSGSLRPPSGGAGFAGSSVAGGSVAGSGFSWALGGT LGSAPGGSHATGALGNVSGVCFIGSEGGLLSGNEKVTMQNLNNRLASYLD NVKALEEANSELERKIKTWHEKYGPGSCRGLDRDYSKYHLTIEDLKSKII SSTAANANIILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDE LTLCRTDQELQYESLSEEMTYLKKNHEEEMKVLQCAAGGNVNVEMNAAPG VDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSATLQQQISNDLGAATSA RTELTELKRSLQTLEIELQSLSATKHSLECSLAETEGNYCSQLAQIQAQI SALEEQLHQVRTETEGQKLEHEQLLDIKAHLEKEIETYCRLIDGDENSCS VSKGFESGTSGNSPKDVSKTTLVKTVVEEIDQRGKVLSSRIHSIEEKMSK MSNGKAEQRVPF


    Database link: A6BLY7

  • Positive control

    • WB: Recombinant mouse K28 protein. Mouse cerebrum lysate.
  • General notes

    Previously labelled as KRT28. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Essential for the proper assembly of types I and II keratin protein complexes and the formation of keratin intermediate filaments in the inner root sheath (irs).
  • Tissue specificity

    Strongly expressed in skin and scalp, and weak expression observed in thymus. In the hair follicle, expressed in Henle layer, Huxley layer and in the irs cuticle. Expression extends from the bulb region up to the point of differentiation into the three layers. Also present in the medulla of beard hair (at protein level).
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK-28 antibody
    • Cytokeratin-28 antibody
    • K1C28_HUMAN antibody
    • K25D antibody
    • K28 antibody
    • Keratin 25D antibody
    • Keratin 28 antibody
    • Keratin antibody
    • Keratin, type I cytoskeletal 28 antibody
    • Keratin-25D antibody
    • Keratin-28 antibody
    • KRT25D antibody
    • KRT28 antibody
    • type I cytoskeletal 28 antibody
    • Type I inner root sheath specific keratin 25 irs4 antibody
    • Type I inner root sheath-specific keratin-K25irs4 antibody
    see all

Images

  • Anti-K28 antibody (ab233161) at 1 µg/ml + Mouse brain tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/1000 dilution
  • Anti-K28 antibody (ab233161) at 1 µg/ml + Mouse cerebrum lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-K28 antibody (ab233161) at 1 µg/ml + Recombinant mouse K28 protein

References

ab233161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up