Overview

  • Product name

    Anti-K33A antibody
  • Description

    Rabbit polyclonal to K33A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human K33A aa 57-363. Expressed in E.coli.
    Sequence:

    KETMQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLVCASYQSY FKTIEELQQKILCSKSENARLVVQIDNAKLASDDFRTKYETELSLRQLVE SDINGLRRILDELTLCRSDLEAQVESLKEELLCLKQNHEQEVNTLRCQLG DRLNVEVDAAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNK QVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAR YSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTY RSLLESE


    Database link: O76009

  • Positive control

    • WB: Recombinant human K33A protein; Human lung lysate; Mouse testis lysate. IHC-P: Human prostate cancer, kidney, cerebrum, glioma, liver and liver cancer tissue.
  • General notes

    Previously labelled as KRT33A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 46 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-K33A antibody (ab233139) at 2 µg + Recombinant human K33A protein

    Predicted band size: 46 kDa

  • Anti-K33A antibody (ab233139) at 1 µg/ml + Human lung lysate

    Predicted band size: 46 kDa

  • Anti-K33A antibody (ab233139) at 1 µg + Mouse testis lysate

    Predicted band size: 46 kDa

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for K33A using ab233139 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up