Overview

  • Product name

  • Description

    Rabbit polyclonal to K80
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human K80 aa 389-452.
    Sequence:

    GEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITE MSEKYFSQESEVSE


    Database link: Q6KB66

  • Positive control

    • ICC/IF: A431 cells.
  • General notes

    Previously labelled as Keratin 80. 

Properties

Applications

Our Abpromise guarantee covers the use of ab222325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

PFA-fixed/Triton X-100 permeabilized

Target

  • Tissue specificity

    Weakly expressed in tongue, but not skin or in any other tissues or organs examined.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CK 80 antibody
    • CK-80 antibody
    • CK80 antibody
    • Cytokeratin 80 antibody
    • Cytokeratin-80 antibody
    • K 80 antibody
    • K2C80_HUMAN antibody
    • K80 antibody
    • KB20 antibody
    • Keratin 80 antibody
    • Keratin antibody
    • Keratin-80 antibody
    • KRT 80 antibody
    • Krt80 antibody
    • type II cytoskeletal 80 antibody
    • Type II keratin antibody
    • Type-II keratin Kb20 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for K80 (green) using ab222325 at 4 µg/ml in ICC/IF.

References

ab222325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up