Overview

  • Product name

  • Description

    Rabbit polyclonal to K85
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human K85 aa 88-137 (N terminal).
    Sequence:

    CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF

  • Positive control

    • OVCAR 3 cell lysate.
  • General notes

    Protein previously labeled as KRT85.

Properties

Applications

Our Abpromise guarantee covers the use of ab136312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa.

Target

  • Relevance

    KRT85 is a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity.
  • Cellular localization

    Intermediate filament, Keratin filament
  • Database links

  • Alternative names

    • ECTD4 antibody
    • Hair keratin K2.12 antibody
    • Hard keratin type II 5 antibody
    • Hb 5 antibody
    • HB5 antibody
    • hHb5 antibody
    • K12.12 antibody
    • K85 antibody
    • Keratin 85 antibody
    • keratin hair basic 5 antibody
    • Keratin type II cuticular Hb5 antibody
    • keratin, hard, type II antibody
    • KRTHB5 antibody
    • type II cuticular Hb5 antibody
    • Type II hair keratin Hb5 antibody
    • Type II keratin Kb25 antibody
    see all

Images

  • Anti-K85 antibody (ab136312) at 1 µg/ml + OVCAR 3 cell lysate at 10 µg

    Secondary
    Goat anti-rabbit IgG HRP

    Developed using the ECL technique.

    Predicted band size: 56 kDa

References

ab136312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Resin sections)
Sample
Human Tissue sections (hair folllicle)
Specification
hair folllicle

Prof. George Rogers

Verified customer

Submitted Jun 30 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up