Overview

  • Product name

    Anti-Kallikrein 10/K10 antibody
    See all Kallikrein 10/K10 primary antibodies
  • Description

    Rabbit polyclonal to Kallikrein 10/K10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Kallikrein 10/K10 aa 35-276.
    Sequence:

    LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA AHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTD EHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKY NKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLV CDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN


    Database link: O43240

  • Positive control

    • WB: Human prostate cancer and pancreatic tissue.
  • General notes

     This product was previously labelled as Kallikrein 10

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Has a tumor-suppressor role for NES1 in breast and prostate cancer.
  • Tissue specificity

    Expressed in breast, ovary and prostate.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Developmental stage

    Down-regulated during breast cancer progression.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Breast normal epithelial cell associated serine protease antibody
    • Kallikrein related peptidase 10 antibody
    • Kallikrein-10 antibody
    • Kallikrein10 antibody
    • KLK 10 antibody
    • KLK10 antibody
    • KLK10_HUMAN antibody
    • NES 1 antibody
    • NES1 antibody
    • Normal epithelial cell specific 1 antibody
    • Normal epithelial cell-specific 1 antibody
    • Protease serine like 1 antibody
    • Protease serine-like 1 antibody
    • PRSS L1 antibody
    • PRSSL 1 antibody
    • PRSSL1 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for Kallikrein 10/K10 using ab229690 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for Kallikrein 10/K10 using ab229690 at 1/100 dilution in immunohistochemical analysis.

References

ab229690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up