Overview

  • Product name

    Anti-Kallikrein 11 antibody
    See all Kallikrein 11 primary antibodies
  • Description

    Rabbit polyclonal to Kallikrein 11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Kallikrein 11 aa 39-282. Expressed in E.coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFILLALATGLVGGET RIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIV HLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPV SITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIE HQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWG QDPCAITRKPGVYTKVCKYVDWIQETMKNN


    Database link: Q9UBX7

  • Positive control

    • IHC-P: Human prostate, prostate cancer, kidney and stomach cancer tissues. WB: Mouse thymus and skin lysates; K562 cell lysate; Recombinant human Kallikrein 11 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function

    Possible multifunctional protease. Efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin. Cleaves synthetic peptides after arginine but not lysine residues.
  • Tissue specificity

    Expressed in brain, skin and prostate. Isoform 1 is expressed preferentially in brain. Isoform 2 is expressed in prostate. Present in seminal plasma at concentrations ranging from 2 to 37 microg/mL (at protein level).
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    About 40% of KLK11 is inactivated by internal cleavage after Arg-188. This proteolytic inactivation may be effected by plasminogen.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hippostasin antibody
    • hK11 antibody
    • Kallikrein 11 antibody
    • Kallikrein 11 isoform 1 preproprotein antibody
    • Kallikrein 11 isoform 2 precursor antibody
    • Kallikrein 11 precursor antibody
    • Kallikrein related peptidase 11 antibody
    • Kallikrein-11 inactive chain 2 antibody
    • KLK 11 antibody
    • Klk11 antibody
    • KLK11_HUMAN antibody
    • MGC33060 antibody
    • Protease serine 20 trypsin like antibody
    • Protease serine trypsin like antibody
    • PRSS20 antibody
    • Serine protease 20 antibody
    • TLSP antibody
    • Trypsin like protease antibody
    • Trypsin-like protease antibody
    see all

Images

  • All lanes : Anti-Kallikrein 11 antibody (ab233278) at 2 µg/ml

    Lane 1 : Mouse thymus lysate
    Lane 2 : Mouse skin lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 31 kDa

  • Paraffin-embedded human prostate tissue stained for Kallikrein 11 using ab233278 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Kallikrein 11 using ab233278 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Kallikrein 11 using ab233278 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for Kallikrein 11 using ab233278 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-Kallikrein 11 antibody (ab233278) at 2 µg/ml + Recombinant human Kallikrein 11 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 31 kDa

References

ab233278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up