Overview

  • Product name

    Anti-Kallikrein 14 antibody
    See all Kallikrein 14 primary antibodies
  • Description

    Rabbit polyclonal to Kallikrein 14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Kallikrein 14 aa 36-267. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    EDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCG RPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQ PARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINI SPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVS WGMERCALPGYPGVYTNLCKYRSWIEETMRDK


    Database link: Q9P0G3

  • Positive control

    • IHC-P: Human breast cancer tissue. WB: Recombinant human KLK14 protein; Pig kidney and human lung tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis.
  • Tissue specificity

    Highly expressed in CNS, bone marrow and fetal liver. Also expressed in breast, thyroid, kidney, colon, pancreas, spleen, prostate, uterus, small intestine, placenta and skeletal muscle. Among 40 tissues tested, the highest expression is detected in skin followed by breast and prostate (at protein level). Expressed in stratum corneum by sweat ducts and sweat glands and detected in sweat (at protein level).
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Proteolytic cleavage of the activation peptide produces the active enzyme.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • hK14 antibody
    • Kallikrein 14 antibody
    • Kallikrein like protein 6 antibody
    • Kallikrein-14 antibody
    • Kallikrein-like protein 6 antibody
    • KLK L6 antibody
    • KLK-L6 antibody
    • KLK14 antibody
    • KLK14_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Kallikrein 14 using ab232966 at 10 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Kallikrein 14 using ab232966 at 10 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Kallikrein 14 antibody (ab232966) at 1 µg/ml + Human lung tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-Kallikrein 14 antibody (ab232966) at 1 µg/ml + Pig kidney tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-Kallikrein 14 antibody (ab232966) at 2 µg/ml + Recombinant human Kallikrein 14 protein

References

ab232966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up