Overview

  • Product name

    Anti-Kallikrein 2/KLK2 antibody
    See all Kallikrein 2/KLK2 primary antibodies
  • Description

    Mouse polyclonal to Kallikrein 2/KLK2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Kallikrein 2/KLK2 aa 1-223.
    Sequence:

    MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHC GGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPL YNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGT TCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAG LWTGGKDTCGVSHPYSQHLEGKG


    Database link: NP_001002231.1

  • Positive control

    • Kallikrein 2/KLK2 transfected 293T cell lysate; Human small intestine tissue.
  • General notes

     This product was previously labelled as Kallikrein 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab169269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 3 µg/ml.

Target

  • Function

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glandular kallikrein 2 antibody
    • Glandular kallikrein-1 antibody
    • hGK 1 antibody
    • hGK-1 antibody
    • hK2 antibody
    • Kallikrein 2 prostatic antibody
    • Kallikrein related peptidase 2 antibody
    • kallikrein, glandular antibody
    • Kallikrein, prostatic antibody
    • Kallikrein-2 antibody
    • KLK 2 antibody
    • Klk-2 antibody
    • Klk2 antibody
    • KLK2_HUMAN antibody
    • KLK2A 2 antibody
    • KLK2A2 antibody
    • MGC12201 antibody
    • Tissue kallikrein 2 antibody
    • Tissue kallikrein-2 antibody
    • Ton antibody
    see all

Images

  • All lanes : Anti-Kallikrein 2/KLK2 antibody (ab169269) at 1 µg/ml

    Lane 1 : Kallikrein 2/KLK2 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Lane 1 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
    Lane 2 : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 25 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling Kallikrein 2/KLK2 with ab169269 at 3 µg/ml.

References

ab169269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up