Overview

  • Product name

    Anti-Kallikrein 2/KLK2 antibody
    See all Kallikrein 2/KLK2 primary antibodies
  • Description

    Rabbit polyclonal to Kallikrein 2/KLK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Kallikrein 2/KLK2 aa 19-261. Expressed in E. coli. N-terminal tag.
    Sequence:

    PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLK KNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSS HDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRP RSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLV CNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP


    Database link: P20151-1

  • Positive control

    • WB: Recombinant human Kallikrein 2/KLK2 protein. Rat prostate gland tissue lysate. IHC-P: Human cerebrum, glioma, prostate, prostate cancer, breast cancer and colorectal cancer tissue.
  • General notes

     This product was previously labelled as Kallikrein 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glandular kallikrein 2 antibody
    • Glandular kallikrein-1 antibody
    • hGK 1 antibody
    • hGK-1 antibody
    • hK2 antibody
    • Kallikrein 2 prostatic antibody
    • Kallikrein related peptidase 2 antibody
    • kallikrein, glandular antibody
    • Kallikrein, prostatic antibody
    • Kallikrein-2 antibody
    • KLK 2 antibody
    • Klk-2 antibody
    • Klk2 antibody
    • KLK2_HUMAN antibody
    • KLK2A 2 antibody
    • KLK2A2 antibody
    • MGC12201 antibody
    • Tissue kallikrein 2 antibody
    • Tissue kallikrein-2 antibody
    • Ton antibody
    see all

Images

  • Anti-Kallikrein 2/KLK2 antibody (ab232980) at 2 µg/ml + Rat prostate gland tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Kallikrein 2/KLK2 with ab232980 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-Kallikrein 2/KLK2 antibody (ab232980) at 2 µg/ml + Recombinant human Kallikrein 2/KLK2 protein

References

ab232980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up