Overview

  • Product name
    Anti-Kallikrein 7 antibody
    See all Kallikrein 7 primary antibodies
  • Description
    Mouse polyclonal to Kallikrein 7
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Kallikrein 7 aa 1-253. NCBI: NP_005037.1
    Sequence:

    MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSG NQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFR HPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWG TTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNA CNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMK KHR


    Database link: P49862

  • Positive control
    • 293T cell line transfected with Kallikrein 7.

Properties

Applications

Our Abpromise guarantee covers the use of ab172088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-
    -Cys-7', '16-Tyr-
    -Leu-17', '25-Phe-
    -Tyr-26' and '26-Tyr-
    -Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
  • Tissue specificity
    Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.
  • Information by UniProt
  • Database links
  • Alternative names
    • Chymotryptic stratum corneum antibody
    • hK 7 antibody
    • hK7 antibody
    • hSCCE antibody
    • Kallikrein 7 (chymotryptic stratum corneum) antibody
    • Kallikrein related peptidase 7 antibody
    • Kallikrein-7 antibody
    • Kallikrein7 antibody
    • KLK 7 antibody
    • Klk7 antibody
    • KLK7_HUMAN antibody
    • Protease serine 6 antibody
    • PRSS 6 antibody
    • PRSS6 antibody
    • SCCE antibody
    • Serine protease 6 antibody
    • Signal protein antibody
    • Stratum corneum chymotryptic enzyme antibody
    see all

Images

  • All lanes : Anti-Kallikrein 7 antibody (ab172088) at 1 µg/ml

    Lane 1 : Kallikrein 7 transfected 293T cell lysate
    Lane 2 : non transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 28 kDa

References

ab172088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up