Overview

  • Product name

    Anti-Kallikrein 8/KLK8 antibody
    See all Kallikrein 8/KLK8 primary antibodies
  • Description

    Rabbit polyclonal to Kallikrein 8/KLK8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Kallikrein 8/KLK8 aa 29-260. (Expressed in E.coli).
    Sequence:

    QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPK YTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRD QASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKI FPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSW GSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG


    Database link: O60259

  • Positive control

    • WB: Mouse ear lysate; Recombinant human Kallikrein 8/KLK8 protein. IHC-P: Human pancreas tissue.
  • General notes

     This product was previously labelled as Kallikrein 8

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function

    Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
  • Tissue specificity

    Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Cytoplasm. Shows a cytoplasmic distribution in the keratinocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Brain serine protease 1 antibody
    • BSP1 antibody
    • hK8 antibody
    • HNP antibody
    • HPN antibody
    • Kallikrein 8 (neuropsin/ovasin) antibody
    • Kallikrein related peptidase 8 antibody
    • Kallikrein-8 antibody
    • Kallikrein8 antibody
    • KLK 8 antibody
    • Klk8 antibody
    • KLK8 protein type 1 antibody
    • KLK8 protein type 2 antibody
    • KLK8_HUMAN antibody
    • Neuropsin antibody
    • neuropsin type 1 antibody
    • Neuropsin type 1, included antibody
    • Neuropsin type 2 antibody
    • Neuropsin type 2, included antibody
    • Neuropsin, mouse, homolog of antibody
    • NP antibody
    • NRPN antibody
    • Ovasin antibody
    • PRO322 antibody
    • Protease serine 19 antibody
    • PRSS 19 antibody
    • PRSS19 antibody
    • Serine protease 19 antibody
    • Serine protease kallikrein antibody
    • Serine protease kallikrein/ovasin/neuropsin antibody
    • Serine protease TADG 14 antibody
    • Serine protease TADG-14 antibody
    • Serine protease TADG14 antibody
    • TADG 14 antibody
    • TADG14 antibody
    • Tumor associated differentially expressed gene 14 antibody
    • Tumor associated differentially expressed gene 14 protein antibody
    • Tumor-associated differentially expressed gene 14 protein antibody
    • UNQ283 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Kallikrein 8/KLK8 using ab232839 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Kallikrein 8/KLK8 antibody (ab232839) at 1 µg/ml + Mouse ear lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 28 kDa

  • Anti-Kallikrein 8/KLK8 antibody (ab232839) at 2 µg/ml + Recombinant human Kallikrein 8/KLK8 protein

    Predicted band size: 28 kDa

References

ab232839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up