Overview

  • Product name

  • Description

    Rabbit polyclonal to KANSL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human KANSL1 aa 128-177 (internal sequence).
    Sequence:

    QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN


    Database link: NP_056258

  • Positive control

    • ACHN cell lysate.
  • General notes

    Previously labelled as MSL1v1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab118187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 121 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificity

    Expressed in the brain.
  • Information by UniProt
  • Database links

  • Alternative names

    • CENP-36 antibody
    • centromere protein 36 antibody
    • DKFZp686P06109 antibody
    • DKFZp727C091 antibody
    • hMSL1v1 antibody
    • hypothetical protein LOC284058 antibody
    • K1267_HUMAN antibody
    • KANSL1 antibody
    • KAT8 regulatory NSL complex subunit 1 antibody
    • KDVS antibody
    • KIAA1267 antibody
    • male-specific lethal 1 homolog antibody
    • MGC102843 antibody
    • MLL1/MLL complex subunit KIAA1267 antibody
    • MSL1 homolog 1 antibody
    • MSL1v1 antibody
    • Non specific lethal 1 homolog antibody
    • NSL complex protein NSL1 antibody
    • NSL1 antibody
    see all

Images

  • Anti-KANSL1 antibody (ab118187) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size: 121 kDa



    Gel concentration: 6-18%

References

ab118187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up