Overview

  • Product name

  • Description

    Rabbit polyclonal to KANSL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KANSL1 aa 815-1086.
    Sequence:

    HHPPHSPLVRQLSTSSDSPAPASSSSQVTASTSQQPVRRRRGESSFDINN IVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKGSPDEENEEIEDLSD AAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANP STPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLA SEDTRCSTPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCT RRTSGSKTGRETEAAPTSPPIV


    Database link: Q7Z3B3

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: A549 cells.
  • General notes

    Previously labelled as MSL1v1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Expressed in the brain.
  • Information by UniProt
  • Database links

  • Alternative names

    • CENP-36 antibody
    • centromere protein 36 antibody
    • DKFZp686P06109 antibody
    • DKFZp727C091 antibody
    • hMSL1v1 antibody
    • hypothetical protein LOC284058 antibody
    • K1267_HUMAN antibody
    • KANSL1 antibody
    • KAT8 regulatory NSL complex subunit 1 antibody
    • KDVS antibody
    • KIAA1267 antibody
    • male-specific lethal 1 homolog antibody
    • MGC102843 antibody
    • MLL1/MLL complex subunit KIAA1267 antibody
    • MSL1 homolog 1 antibody
    • MSL1v1 antibody
    • Non specific lethal 1 homolog antibody
    • NSL complex protein NSL1 antibody
    • NSL1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for KANSL1 using ab230008 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for KANSL1 (green) using ab230008 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488-conjugated Goat anti-Rabbit IgG (H+L).

References

ab230008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up