Recombinant

Recombinant Anti-Kappa light chain antibody [IGKC/1999R] (ab238009)

Overview

  • Product name

    Anti-Kappa light chain antibody [IGKC/1999R]
    See all Kappa light chain primary antibodies
  • Description

    Rabbit monoclonal [IGKC/1999R] to Kappa light chain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Kappa light chain aa 1-117.
    Sequence:

    MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQG ISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSL QPEDFATYYCQQYNSYP


    Database link: P01601

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at RT.

Target

  • Relevance

    Immunoglobulins belong to a group of related glyco proteins which make up 20% of serum proteins. Antigens and immunoglobulins react to confer immunity to individuals. Immunoglobulins have similar structures of two identical heavy chains and two identical light chains. Both the heavy chains and the light chains are divided into constant and variable regions. The constant regions have the same amino acid sequences between all the immunoglobulin classes. The variable regions have approximately 110 amino acids with high sequence variability. The amino acid sequence of the heavy chain determines the class of an immunoglobulin. The five types of immunoglobulin heavy chains are known as: IgG, IgA, IgM, IgD, and IgE. IgG is divided into four subclasses, and IgA is divided into two subclasses. In serum IgA and IgG are monomers with a single 4 polypeptide unit; while, IgM is a pen tamer. IgA may also form polymers. Kappa light chain antibody can be used for the identification of leukemias, plasmacytomas and certain non Hodgkin's lymphomas. Kappa light chain contains one immunoglobulin like domain. The EU sequence has the INV allotypic marker, Ala 45 and Val 83. The ROY sequence has the INV allotypic marker, Ala 45 and Leu 83.
  • Cellular localization

    Cytoplasmic and Secreted
  • Database links

  • Alternative names

    • HCAK 1 antibody
    • HCAK1 antibody
    • Ig kappa chain C region antibody
    • IGKC antibody
    • IGKCD antibody
    • Immunoglobulin InV antibody
    • Immunoglobulin kappa constant antibody
    • Immunoglobulin kappa constant region antibody
    • Immunoglobulin kappa light chain antibody
    • Immunoglobulin kappa light chain constant region antibody
    • Immunoglobulin KM antibody
    • Kappa 1 immunoglobulin light chain antibody
    • kappa light chain antibody
    • Km antibody
    • MGC111575 antibody
    • MGC62011 antibody
    • MGC72072 antibody
    • MGC88770 antibody
    • MGC88771 antibody
    • MGC88809 antibody
    see all

Images

  • ab238009 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for Kappa light chain using ab238009 at 1 μg/ml in immunohistochemical analysis.

References

ab238009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up