Recombinant Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
Key features and details
- Produced recombinantly (animal-free) for high batch-to-batch consistency and long term security of supply
- Mouse monoclonal [rKLC264] to Kappa light chain - BSA and Azide free
- Suitable for: Protein Array, IHC-P
- Reacts with: Human
Overview
-
Product name
Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free
See all Kappa light chain primary antibodies -
Description
Mouse monoclonal [rKLC264] to Kappa light chain - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: Protein Array, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Kappa light chain aa 1-117.
Sequence:MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQG ISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSL QPEDFATYYCQQYNSYP
Database link: P01601 -
Positive control
- IHC-P: Human tonsil tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein A/G purified -
Purification notes
Purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
rKLC264 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab237851 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Protein Array | Use at an assay dependent concentration. | |
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Incubate with primary antibody for 30 minutes at RT |
Target
-
Relevance
Immunoglobulins belong to a group of related glyco proteins which make up 20% of serum proteins. Antigens and immunoglobulins react to confer immunity to individuals. Immunoglobulins have similar structures of two identical heavy chains and two identical light chains. Both the heavy chains and the light chains are divided into constant and variable regions. The constant regions have the same amino acid sequences between all the immunoglobulin classes. The variable regions have approximately 110 amino acids with high sequence variability. The amino acid sequence of the heavy chain determines the class of an immunoglobulin. The five types of immunoglobulin heavy chains are known as: IgG, IgA, IgM, IgD, and IgE. IgG is divided into four subclasses, and IgA is divided into two subclasses. In serum IgA and IgG are monomers with a single 4 polypeptide unit; while, IgM is a pen tamer. IgA may also form polymers. Kappa light chain antibody can be used for the identification of leukemias, plasmacytomas and certain non Hodgkin's lymphomas. Kappa light chain contains one immunoglobulin like domain. The EU sequence has the INV allotypic marker, Ala 45 and Val 83. The ROY sequence has the INV allotypic marker, Ala 45 and Leu 83. -
Cellular localization
Cytoplasmic and Secreted -
Database links
- Entrez Gene: 28901 Human
- Entrez Gene: 3514 Human
- Omim: 147200 Human
- SwissProt: P01601 Human
- SwissProt: P01834 Human
- Unigene: 449609 Human
-
Alternative names
- HCAK 1 antibody
- HCAK1 antibody
- Ig kappa chain C region antibody
see all
Images
-
This data was produced with ab238007, the same antibody in a different formulation with BSA and Azide.
ab238007 was tested in protein array against over 19000 different full-length human proteins.
Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
Formalin-fixed, paraffin-embedded human tonsil tissue stained for Kappa light chain using ab237851 at 1 μg/ml in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab237851 has not yet been referenced specifically in any publications.