For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    kappa-light-chain-antibody-rklc264-bsa-and-azide-free-ab237851.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Immunoglobulins Light Chain Kappa
Share by email
Recombinant

Recombinant Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Protein Array - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
  • Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)

Key features and details

  • Produced recombinantly (animal-free) for high batch-to-batch consistency and long term security of supply
  • Mouse monoclonal [rKLC264] to Kappa light chain - BSA and Azide free
  • Suitable for: Protein Array, IHC-P
  • Reacts with: Human

You may also be interested in

Conjugation
Product image
Alexa Fluor® 488 Conjugation Kit (Fast) - Lightning-Link® (ab236553)

View more associated products

Overview

  • Product name

    Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free
    See all Kappa light chain primary antibodies
  • Description

    Mouse monoclonal [rKLC264] to Kappa light chain - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Kappa light chain aa 1-117.
    Sequence:

    MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQG ISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSL QPEDFATYYCQQYNSYP


    Database link: P01601
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human tonsil tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: PBS
  • Carrier free

    Yes
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    rKLC264
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Immunoglobulins
    • Light Chain
    • Kappa
    • Epigenetics and Nuclear Signaling
    • ChIP assays
    • ChIP kits

Associated products

  • Alternative Versions

    • Anti-Kappa light chain antibody [rKLC264] (ab238007)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • FITC Conjugation Kit (Fast) - Lightning-Link® (ab188285)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)

Applications

Our Abpromise guarantee covers the use of ab237851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at RT

Target

  • Relevance

    Immunoglobulins belong to a group of related glyco proteins which make up 20% of serum proteins. Antigens and immunoglobulins react to confer immunity to individuals. Immunoglobulins have similar structures of two identical heavy chains and two identical light chains. Both the heavy chains and the light chains are divided into constant and variable regions. The constant regions have the same amino acid sequences between all the immunoglobulin classes. The variable regions have approximately 110 amino acids with high sequence variability. The amino acid sequence of the heavy chain determines the class of an immunoglobulin. The five types of immunoglobulin heavy chains are known as: IgG, IgA, IgM, IgD, and IgE. IgG is divided into four subclasses, and IgA is divided into two subclasses. In serum IgA and IgG are monomers with a single 4 polypeptide unit; while, IgM is a pen tamer. IgA may also form polymers. Kappa light chain antibody can be used for the identification of leukemias, plasmacytomas and certain non Hodgkin's lymphomas. Kappa light chain contains one immunoglobulin like domain. The EU sequence has the INV allotypic marker, Ala 45 and Val 83. The ROY sequence has the INV allotypic marker, Ala 45 and Leu 83.
  • Cellular localization

    Cytoplasmic and Secreted
  • Database links

    • Entrez Gene: 28901 Human
    • Entrez Gene: 3514 Human
    • Omim: 147200 Human
    • SwissProt: P01601 Human
    • SwissProt: P01834 Human
    • Unigene: 449609 Human
    • Alternative names

      • HCAK 1 antibody
      • HCAK1 antibody
      • Ig kappa chain C region antibody
      • IGKC antibody
      • IGKCD antibody
      • Immunoglobulin InV antibody
      • Immunoglobulin kappa constant antibody
      • Immunoglobulin kappa constant region antibody
      • Immunoglobulin kappa light chain antibody
      • Immunoglobulin kappa light chain constant region antibody
      • Immunoglobulin KM antibody
      • Kappa 1 immunoglobulin light chain antibody
      • kappa light chain antibody
      • Km antibody
      • MGC111575 antibody
      • MGC62011 antibody
      • MGC72072 antibody
      • MGC88770 antibody
      • MGC88771 antibody
      • MGC88809 antibody
      see all

    Images

    • Protein Array - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
      Protein Array - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
      This data was produced with ab238007, the same antibody in a different formulation with BSA and Azide.
      ab238007 was tested in protein array against over 19000 different full-length human proteins.
      Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
      A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)

      Formalin-fixed, paraffin-embedded human tonsil tissue stained for Kappa light chain using ab237851 at 1 μg/ml in immunohistochemical analysis.

    • Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)
      Anti-Kappa light chain antibody [rKLC264] - BSA and Azide free (ab237851)

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab237851? Please let us know so that we can cite the reference in this datasheet.

    ab237851 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab237851.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.