Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)

Submit a review Submit a question

Key features and details

  • Mouse polyclonal to Kappa Opioid Receptor - N-terminal
  • Suitable for: WB
  • Reacts with: Rat, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-Kappa Opioid Receptor antibody - N-terminal
    See all Kappa Opioid Receptor primary antibodies

  • Description

    Mouse polyclonal to Kappa Opioid Receptor - N-terminal

  • Host species

    Mouse

  • Tested applications

    Suitable for: WBmore details

  • Species reactivity

    Reacts with: Rat, Human

  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human Kappa Opioid Receptor aa 1-58 (N terminal). NP_000903.
    Sequence:

    MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE PAHISPAI


    Database link: P41145

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Rat kidney tissue lysate, Human ovarian cancer tissue lysate; recombinant Human Kappa Opioid Receptor protein (immunogen).

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    Constituent: 50% Glycerol (glycerin, glycerine)
  • Concentration information loading...

  • Purity

    Whole antiserum

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for dynorphins. May play a role in arousal and regulation of autonomic and neuroendocrine functions.

  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.

  • Cellular localization

    Cell membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • K-OR-1 antibody
      • Kappa opioid receptor antibody
      • Kappa type opioid receptor antibody
      • Kappa-type opioid receptor antibody
      • KOR 1 antibody
      • KOR antibody
      • KOR-1 antibody
      • Opiate receptor kappa 1 antibody
      • Opiate receptor, kappa 1 antibody
      • Opioid receptor, kappa 1 antibody
      • OPRK 1 antibody
      • OPRK antibody
      • OPRK_HUMAN antibody
      • OPRK1 antibody
      • Oprk2 antibody
      • R21 antibody
      see all

    Images

    • Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Rat kidney tissue lysate at 50 µg

      Developed using the ECL technique.

      Predicted band size: 42 kDa

    • Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Human ovarian cancer tissue lysate at 50 µg

      Developed using the ECL technique.

      Predicted band size: 42 kDa

    • Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Western blot - Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
      Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/1000 dilution + recombinant Human Kappa Opioid Receptor protein (immunogen) at 0.2 µg

      Developed using the ECL technique.

      Predicted band size: 42 kDa



      Predicted MWt of immunogen: 32.49 KDa.

    References (0)

    Publishing research using ab194371? Please let us know so that we can cite the reference in this datasheet.

    ab194371 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab194371.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com