Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Kappa Opioid Receptor antibody - N-terminal
See all Kappa Opioid Receptor primary antibodies -
Description
Mouse polyclonal to Kappa Opioid Receptor - N-terminal -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human Kappa Opioid Receptor aa 1-58 (N terminal). NP_000903.
Sequence:MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE PAHISPAI
Database link: P41145 -
Positive control
- Rat kidney tissue lysate, Human ovarian cancer tissue lysate; recombinant Human Kappa Opioid Receptor protein (immunogen).
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 50% Glycerol -
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab194371 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Predicted molecular weight: 42 kDa. |
Target
-
Function
Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for dynorphins. May play a role in arousal and regulation of autonomic and neuroendocrine functions. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4986 Human
- Entrez Gene: 29335 Rat
- Omim: 165196 Human
- SwissProt: P41145 Human
- SwissProt: P34975 Rat
- Unigene: 106795 Human
- Unigene: 89571 Rat
-
Alternative names
- K-OR-1 antibody
- Kappa opioid receptor antibody
- Kappa type opioid receptor antibody
see all
Images
-
Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Rat kidney tissue lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 42 kDa -
Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Human ovarian cancer tissue lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 42 kDa -
Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/1000 dilution + recombinant Human Kappa Opioid Receptor protein (immunogen) at 0.2 µg
Developed using the ECL technique.
Predicted band size: 42 kDaPredicted MWt of immunogen: 32.49 KDa.
Protocols
Datasheets and documents
References
ab194371 has not yet been referenced specifically in any publications.