Overview

  • Product name

    Anti-Kappa Opioid Receptor antibody - N-terminal
    See all Kappa Opioid Receptor primary antibodies
  • Description

    Mouse polyclonal to Kappa Opioid Receptor - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human Kappa Opioid Receptor aa 1-58 (N terminal). NP_000903.
    Sequence:

    MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE PAHISPAI


    Database link: P41145

  • Positive control

    • Rat kidney tissue lysate, Human ovarian cancer tissue lysate; recombinant Human Kappa Opioid Receptor protein (immunogen).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for dynorphins. May play a role in arousal and regulation of autonomic and neuroendocrine functions.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • K-OR-1 antibody
    • Kappa opioid receptor antibody
    • Kappa type opioid receptor antibody
    • Kappa-type opioid receptor antibody
    • KOR 1 antibody
    • KOR antibody
    • KOR-1 antibody
    • Opiate receptor kappa 1 antibody
    • Opiate receptor, kappa 1 antibody
    • Opioid receptor, kappa 1 antibody
    • OPRK 1 antibody
    • OPRK antibody
    • OPRK_HUMAN antibody
    • OPRK1 antibody
    • Oprk2 antibody
    • R21 antibody
    see all

Images

  • Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Rat kidney tissue lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 42 kDa

  • Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/500 dilution + Human ovarian cancer tissue lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 42 kDa

  • Anti-Kappa Opioid Receptor antibody - N-terminal (ab194371) at 1/1000 dilution + recombinant Human Kappa Opioid Receptor protein (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 42 kDa



    Predicted MWt of immunogen: 32.49 KDa.

References

ab194371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up