Overview

  • Product name

    Anti-KAR antibody
  • Description

    Rabbit polyclonal to KAR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human KAR aa 40-181.
    Sequence:

    GNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQ VSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYE YPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSK


    Database link: Q53GQ0

  • Positive control

    • WB: U-251 MG and A431 whole cell lysates. IHC-P: Human breast cancer and small intestine tissues. ICC/IF: U-251 MG cells.
  • General notes

    Previously labelled as HSD17B12. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation.
  • Tissue specificity

    Expressed in most tissues tested. Highly expressed in the ovary and mammary. Expressed in platelets.
  • Pathway

    Steroid biosynthesis; estrogen biosynthesis.
    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Domain

    The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 12,3-ketoacyl-CoA reductase,short chain antibody
    • 17 beta HSD 12 antibody
    • 17 beta hydroxysteroid dehydrogenase 12 antibody
    • 17-@beta-HSD XII antibody
    • 17-@beta-hydroxysteroid dehydrogenase XII antibody
    • 17-beta-HSD 12 antibody
    • 17-beta-hydroxysteroid dehydrogenase 12 antibody
    • 17beta HSD type 12 antibody
    • 3 ketoacyl CoA reductase antibody
    • 3-ketoacyl-CoA reductase antibody
    • DHB12_HUMAN antibody
    • Estradiol 17 beta dehydrogenase 12 antibody
    • Estradiol 17-beta-dehydrogenase 12 antibody
    • HSD17B12 antibody
    • Hydroxysteroid (17-beta) dehydrogenase 12 antibody
    • KAR antibody
    • KIK-I antibody
    • Kik1 antibody
    • SDR12C1 antibody
    • Short chain dehydrogenase/reductase family 12C member 1 antibody
    • Steroid dehydrogenase homolog antibody
    see all

Images

  • All lanes : Anti-KAR antibody (ab236990) at 1/500 dilution

    Lane 1 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 2 : A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 34 kDa

  • Paraffin-embedded human breast cancer tissue stained for KAR using ab236990 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for KAR using ab236990 at 1/100 dilution in immunohistochemical analysis.

  • U-251 MG (human brain glioma cell line) cells labeling KAR using ab236990 (green) at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up