Overview

  • Product name

  • Description

    Rabbit polyclonal to KAT2/AadAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human KAT2/AadAT aa 51-100.
    Sequence:

    AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

  • Positive control

    • HepG2 cells; kidney.
  • General notes

     This product was previously labelled as Aminoadipate aminotransferase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab59132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

  • Function

    Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
  • Tissue specificity

    Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
  • Pathway

    Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 4/6.
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 aminoadipate aminotransferase antibody
    • 2 aminoadipate transaminase antibody
    • 2-aminoadipate aminotransferase antibody
    • 2-aminoadipate transaminase antibody
    • Aadat antibody
    • AADAT_HUMAN antibody
    • Aadt antibody
    • AI875679 antibody
    • Alpha aminoadipate aminotransferase antibody
    • Alpha-aminoadipate aminotransferase antibody
    • Aminoadipate aminotransferase antibody
    • EC 2.6.1.39 antibody
    • EC 2.6.1.7 antibody
    • KAT/AadAT antibody
    • KAT2 antibody
    • KATII antibody
    • Kynurenine oxoglutarate transaminase 2 antibody
    • Kynurenine aminotransferase II antibody
    • Kynurenine oxoglutarate aminotransferase II antibody
    • Kynurenine oxoglutarate transaminase II antibody
    • Kynurenine--oxoglutarate aminotransferase II antibody
    • Kynurenine--oxoglutarate transaminase II antibody
    • Kynurenine/alpha-aminoadipate aminotransferase mitochondrial [Precursor] antibody
    • Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial antibody
    • L kynurenine/alpha aminoadipate aminotransferase antibody
    see all

Images

  • Anti-KAT2/AadAT antibody (ab59132) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling KAT2/AadAT with ab59132 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

ab59132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab59132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up