Overview

  • Product name

  • Description

    Rabbit polyclonal to KAT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human KAT3 aa 37-86 (N terminal).
    Sequence:

    LKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELS

  • Positive control

    • Jurkat cell lysate.
  • General notes

     This product was previously labelled as CCBL2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab56028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 43 kDa (predicted molecular weight: 51 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Function

    Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCBL 2 antibody
    • Cysteine conjugate beta lyase 2 antibody
    • Cysteine S conjugate beta lyase 2 antibody
    • Cysteine-S-conjugate beta-lyase 2 antibody
    • DKFZp547N1117 antibody
    • DKFZp667D0223 antibody
    • KAT 3 antibody
    • KAT III antibody
    • KAT3 antibody
    • KAT3_HUMAN antibody
    • KATIII antibody
    • kyat3 antibody
    • Kynurenine aminotransferase 3 antibody
    • Kynurenine aminotransferase III antibody
    • Kynurenine oxoglutarate transaminase 3 antibody
    • Kynurenine oxoglutarate transaminase III antibody
    • Kynurenine--glyoxylate transaminase antibody
    • Kynurenine--oxoglutarate transaminase 3 antibody
    • Kynurenine--oxoglutarate transaminase III antibody
    • MGC9398 antibody
    • RBM1 antibody
    • RBMX L1 antibody
    • RBMXL 1 antibody
    • RBMXL1 antibody
    • RNA binding motif protein X linked like 1 antibody
    • RP11 82K18.3 antibody
    • RP4 531M19.2 antibody
    see all

Images

  • Anti-KAT3 antibody (ab56028) at 2.5 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa
    Observed band size: 43 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%

References

ab56028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab56028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up