Overview

  • Product name

    Anti-KAT5 / Tip60 antibody
    See all KAT5 / Tip60 primary antibodies
  • Description

    Mouse polyclonal to KAT5 / Tip60
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein corresponding to Human KAT5/ Tip60 aa 1-513.
    Sequence:

    MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDF NKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQ ASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRK VEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQ DSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPY PQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTG TPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSI KKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCL HFTPKDWSKRGKW


    Database link: NP_006379.2

  • Positive control

    • KAT5 / Tip60 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

  • Function

    Catalytic subunit of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Directly acetylates and activates ATM. In case of HIV-1 infection, interaction with the viral Tat protein leads to KAT5 polyubiquitination and targets it to degradation.
  • Sequence similarities

    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
  • Post-translational
    modifications

    Sumoylated by UBE2I at Lys-430 and Lys-451, leading to increase of its histone acetyltransferase activity in UV-induced DNA damage response, as well as its translocation to nuclear bodies.
    Phosphorylated on Ser-86 and Ser-90; enhanced during G2/M phase. Phosphorylated form has a higher activity.
    Ubiquitinated by MDM2, leading to its proteasome-dependent degradation.
  • Cellular localization

    Nucleus > nucleolus. Cytoplasm > perinuclear region. Upon stimulation with EDN1, it is exported from the nucleus to the perinuclear region and UV irradiation induces translocation into punctuate subnuclear structures named nuclear bodies.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa Tat interactive protein antibody
    • 60 kDa Tat-interactive protein antibody
    • cPLA(2) interacting protein antibody
    • cPLA(2)-interacting protein antibody
    • cPLA2 antibody
    • cPLA2 interacting protein antibody
    • ESA1 antibody
    • Histone acetyltransferase HTATIP antibody
    • Histone acetyltransferase KAT5 antibody
    • HIV 1 Tat interactive protein antibody
    • HIV 1 Tat interactive protein, 60kDa antibody
    • HIV-1 Tat interactive protein antibody
    • HTATIP antibody
    • HTATIP1 antibody
    • K(lysine) acetyltransferase 5 antibody
    • K-acetyltransferase 5 antibody
    • KAT5 antibody
    • KAT5_HUMAN antibody
    • Lysine acetyltransferase 5 antibody
    • PLIP antibody
    • Tat interacting protein, 60kDa antibody
    • TIP antibody
    • Tip60 antibody
    see all

Images

  • All lanes : Anti-KAT5 / Tip60 antibody (ab172415) at 1 µg/ml

    Lane 1 : KAT5 / Tip60 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 59 kDa

References

ab172415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Drosophila melanogaster Tissue lysate - nuclear (Adult heads (cytoplasm and nuclear extract))
Gel Running Conditions
Reduced Denaturing (8)
Loading amount
20 µg
Specification
Adult heads (cytoplasm and nuclear extract)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 28 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up