Overview

  • Product name

    Anti-KAT8 / MYST1 / MOF antibody
    See all KAT8 / MYST1 / MOF primary antibodies
  • Description

    Rabbit polyclonal to KAT8 / MYST1 / MOF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human KAT8/ MYST1/ MOF aa 1-168.
    Sequence:

    MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE PEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRL DEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEIN HVQKTYAEMDPTTAALEK


    Database link: Q9H7Z6

  • Positive control

    • WB: MCF7, HepG2 and Jurkat whole cell lysate (ab7899); mouse and rat liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 53 kDa (predicted molecular weight: 52 kDa).

Target

  • Function

    Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM.
  • Sequence similarities

    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
    Contains 1 chromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Histone acetyltransferase KAT8 antibody
    • Histone acetyltransferase MYST1 antibody
    • hMOF antibody
    • K(lysine) acetyltransferase 8 antibody
    • KAT 8 antibody
    • Lysine acetyltransferase 8 antibody
    • MOF antibody
    • MOZ antibody
    • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1 antibody
    • MYST 1 antibody
    • MYST histone acetyltransferase 1 antibody
    • myst protein 1 antibody
    • MYST-1 antibody
    • MYST1 antibody
    • MYST1_HUMAN antibody
    • Ortholog of Drosophila males absent on the first (MOF) antibody
    • Probable histone acetyltransferase MYST1 antibody
    • SAS2 and TIP60 protein 1 antibody
    • SAS2 antibody
    • SAS3 antibody
    • TIP60 protein 1 antibody
    • YBF2 antibody
    • YBF2/SAS3 antibody
    • ZC2HC8 antibody
    see all

Images

  • All lanes : Anti-KAT8 / MYST1 / MOF antibody (ab224597) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 4 : Mouse liver tissue lysate
    Lane 5 : Rat liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa
    Observed band size: 53 kDa
    why is the actual band size different from the predicted?

References

ab224597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up