Overview

  • Product name

    Anti-KAZALD1 antibody
  • Description

    Rabbit polyclonal to KAZALD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human KAZALD1 aa 31-304. Full length mature chain, expressed in E. coli.
    Sequence:

    RPSPGPDYLRRGWMRLLAEGEGCAPCRPEECAAPRGCLAGRVRDACGCCW ECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGEVPEPLCACRS QSPLCGSDGHTYSQICRLQEAARARPDANLTVAHPGPCESGPQIVSHPYD TWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQ RFEVTGWLQIQAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTG IPQLRSLNLVPEEEAESEENDDYY


    Database link: Q96I82-1

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human KAZALD1 protein; Cow stomach lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function

    Involved in the proliferation of osteoblasts during bone formation and bone regeneration. Promotes matrix assembly.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Kazal-type serine protease inhibitor domain-containing protein 1 antibody
    • KAZALD1 antibody
    • KAZD1_HUMAN antibody

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for KAZALD1 with ab231151 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-KAZALD1 antibody (ab231151) at 2 µg/ml + Cow stomach lysate

    Predicted band size: 33 kDa

  • Anti-KAZALD1 antibody (ab231151) at 2 µg/ml + Recombinant human KAZALD1 protein

    Predicted band size: 33 kDa

References

ab231151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up