Overview

  • Product name

  • Description

    Rabbit polyclonal to Kazrin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Kazrin aa 647-742.
    Sequence:

    PTFNAEAMATALGIPSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTP PGRASSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDY


    Database link: Q674X7

  • Positive control

    • IHC-P: Humanspleen tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of the cornified envelope of keratinocytes. May be involved in the interplay between adherens junctions and desmosomes. The function in the nucleus is not known.
  • Tissue specificity

    Isoform 2, isoform 3 and isoform 4 are expressed in several cell lines including keratinocytes and bladder and epidermoid carcinoma (at protein level). Isoform 2, isoform 3 and isoform 4 are expressed in hair follicle and interfollicular epidermis (at protein level).
  • Sequence similarities

    Belongs to the kazrin family.
    Contains 3 SAM (sterile alpha motif) domains.
  • Cellular localization

    Cytoplasm > cytoskeleton and Cytoplasm. Cell junction > desmosome. Nucleus. Observed at the apical plasma mebrane of keratinocytes. Partially colocalizes with PPL and DP at desmosomes, and with PP at the interdesmosomal plasma membrane. Colocalizes with cortical actin-based membrane structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • HRIHFB2003 antibody
    • KAZ antibody
    • Kazn antibody
    • Kazrin antibody
    • KAZRN_HUMAN antibody
    • KIAA1026 antibody
    • RP1-21O18.1 antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for Kazrin using ab244447 at 1/5000 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Kazrin (green) using ab244447 at 4 μg/ml in ICC/IF.

References

ab244447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up