Overview

  • Product name

    Anti-KBTB6/KBTBD6 antibody
    See all KBTB6/KBTBD6 primary antibodies
  • Description

    Rabbit polyclonal to KBTB6/KBTBD6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human KBTB6/KBTBD6 aa 1-139.
    Sequence:

    MQSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALL AQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMF TGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEA


    Database link: Q86V97

  • Positive control

    • WB: HeLa cell lysate; mouse liver, kidney and brain tissue lysates. IHC-P: Human liver tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as KBTB6

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 77, 50 kDa (predicted molecular weight: 76 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for KBTB6/KBTBD6 (green) using ab222971 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human liver tissue stained for KBTB6/KBTBD6 using ab222971 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-KBTB6/KBTBD6 antibody (ab222971) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 76 kDa
    Observed band size: 50,77 kDa
    why is the actual band size different from the predicted?

References

ab222971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up