Overview

  • Product name

  • Description

    Rabbit polyclonal to KBTBD7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KBTBD7 aa 475-684.
    Sequence:

    YSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDE IYCICDIPVMKVYNPARGEWRRISNIPLDSETHNYQIVNHDQKLLLITST TPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLE PGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEVWVQVAPQ RNAQDQQGSL


    Database link: Q8WVZ9

  • Positive control

    • WB: HL-60, A549 and HEK-293T whole cell lysate. IHC-P: Human testis and brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 77 kDa (predicted molecular weight: 77 kDa).
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 5 Kelch repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110008P08Rik antibody
    • AU045792 antibody
    • DKFZP434E2318 antibody
    • Gm295 antibody
    • KBTB7_HUMAN antibody
    • KBTBD 7 antibody
    • KBTBD7 antibody
    • Kelch repeat and BTB (POZ) domain containing 7 antibody
    • Kelch repeat and BTB domain containing protein 7 antibody
    • Kelch repeat and BTB domain-containing protein 7 antibody
    • OTTHUMP00000018313 antibody
    see all

Images

  • All lanes : Anti-KBTBD7 antibody (ab230126) at 1/1000 dilution

    Lane 1 : HL-60 (Human promyelocytic leukemia cell line) whole cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) whole cell lysate
    Lane 3 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 77 kDa

  • Paraffin-embedded human testis tissue stained for KBTBD7 with ab230126 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for KBTBD7 with ab230126 at 1/100 dilution in immunohistochemical analysis.

References

ab230126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up