Overview

  • Product name

    Anti-KCMF1 antibody
  • Description

    Rabbit polyclonal to KCMF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Xenopus laevis, Zebrafish
  • Immunogen

    Recombinant fragment corresponding to Human KCMF1 aa 98-226.
    Sequence:

    TSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPRDLDESSG VRHVRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMD PIAELLSQLSGVRRSAGGQLNSSGPSASQ


    Database link: Q9P0J7

  • Positive control

    • IHC-P: Human colon cancer and endometrial cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Relevance

    KCMF1 has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.
  • Database links

  • Alternative names

    • DEBT 91 antibody
    • DEBT91 antibody
    • Differentially expressed in branching tubulogenesis 91 antibody
    • DKFZP434L1021 antibody
    • E3 ubiquitin protein ligase KCMF1 antibody
    • FGF induced in gastric cancer antibody
    • FGF induced ubiquitin protein ligase in gastric cancers antibody
    • FIGC antibody
    • KCMF 1 antibody
    • KCMF1 antibody
    • PCMF antibody
    • Potassium channel modulatory factor antibody
    • Potassium channel modulatory factor 1 antibody
    • Zinc finger ZZ domain containing 1 antibody
    • ZZ type zinc finger containing protein 1 antibody
    • ZZZ 1 antibody
    • ZZZ1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for KCMF1 with ab237058 at a 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human endometrial cancer tissue stained for KCMF1 with ab237058 at a 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab237058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up