Overview

  • Product name

    Anti-KCNH7 antibody
  • Description

    Rabbit polyclonal to KCNH7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human KCNH7 aa 146-195 (N terminal). The exact sequence is proprietary.
    Sequence:

    PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV


    Database link: Q9NS40

  • Positive control

    • 721_B cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab80455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

WB Use a concentration of 1 µg/ml. Detects a band of approximately 83 kDa (predicted molecular weight: 83 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-KCNH7 antibody (ab80455) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 83 kDa
    Observed band size: 83 kDa

References

This product has been referenced in:

  • Xiao K  et al. ERG3 potassium channel-mediated suppression of neuronal intrinsic excitability and prevention of seizure generation in mice. J Physiol N/A:N/A (2018). Read more (PubMed: 30016551) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up