Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNJ1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KCNJ1 aa 303-387.
    Sequence:

    STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVET PHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD


    Database link: P48048

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
  • Tissue specificity

    In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.
  • Involvement in disease

    Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) [MIM:241200]; also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ1 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP regulated potassium channel ROM K antibody
    • ATP sensitive inward rectifier potassium channel 1 antibody
    • ATP-regulated potassium channel ROM-K antibody
    • ATP-sensitive inward rectifier potassium channel 1 antibody
    • Inward rectifier K(+) channel Kir1.1 antibody
    • inwardly rectifying K+ channel antibody
    • inwardly rectifying subfamily J member 1 antibody
    • IRK1_HUMAN antibody
    • KCNJ 1 antibody
    • KCNJ antibody
    • Kcnj1 antibody
    • Kir 1.1 antibody
    • Kir1.1 antibody
    • OTTHUMP00000045938 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 1 antibody
    • potassium inwardly-rectifying channel J1 antibody
    • ROMK 1 antibody
    • ROMK 2 antibody
    • ROMK antibody
    • ROMK1 antibody
    • ROMK2 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for KCNJ1 using ab224749 at 1/50 dilution in immunohistochemical analysis.

References

ab224749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up