Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNJ15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human KCNJ15 aa 81-126. The exact sequence is proprietary.
    Sequence:

    FGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQT


    Database link: Q99712

  • Positive control

    • A549, sp2/0 and PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200642 was purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 43 kDa.

Target

  • Function

    Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP sensitive inward rectifier potassium channel 15 antibody
    • ATP-sensitive inward rectifier potassium channel 15 antibody
    • Inward rectifier K(+) channel Kir1.3 antibody
    • Inward rectifier K(+) channel Kir4.2 antibody
    • Inward rectifier K+ channel KIR4.2 antibody
    • inwardly rectifying subfamily J member 15 antibody
    • IRK15_HUMAN antibody
    • IRKK antibody
    • KCNJ 14 antibody
    • KCNJ 15 antibody
    • KCNJ14 antibody
    • Kcnj15 antibody
    • KIR1.3 antibody
    • KIR4.2 antibody
    • MGC13584 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 15 antibody
    • Potassium inwardly rectifying channel J15 antibody
    • Potassium inwardly rectifying channel subfamily J member 15 antibody
    • Potassium voltage gated channel subfamily J member 15 antibody
    see all

Images

  • All lanes : Anti-KCNJ15 antibody (ab200642)

    Lane 1 : A549 whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 43 kDa

References

ab200642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up