Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNJ15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig
  • Immunogen

    Recombinant fragment corresponding to Human KCNJ15 aa 291-368.
    Sequence:

    SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCT FYCADSEKQQLEEKYRQEDQRERELRTL


    Database link: Q99712

  • Positive control

    • IHC-P: Human small intestine tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP sensitive inward rectifier potassium channel 15 antibody
    • ATP-sensitive inward rectifier potassium channel 15 antibody
    • Inward rectifier K(+) channel Kir1.3 antibody
    • Inward rectifier K(+) channel Kir4.2 antibody
    • Inward rectifier K+ channel KIR4.2 antibody
    • inwardly rectifying subfamily J member 15 antibody
    • IRK15_HUMAN antibody
    • IRKK antibody
    • KCNJ 14 antibody
    • KCNJ 15 antibody
    • KCNJ14 antibody
    • Kcnj15 antibody
    • KIR1.3 antibody
    • KIR4.2 antibody
    • MGC13584 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 15 antibody
    • Potassium inwardly rectifying channel J15 antibody
    • Potassium inwardly rectifying channel subfamily J member 15 antibody
    • Potassium voltage gated channel subfamily J member 15 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for KCNJ15 using ab224384 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for KCNJ15 (green) using ab224384 at 4 µg/ml in ICC/IF.

References

ab224384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up