Overview

  • Product name

    Anti-KCNJ5 antibody [8D2]
    See all KCNJ5 primary antibodies
  • Description

    Mouse monoclonal [8D2] to KCNJ5
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human KCNJ5 aa 321-419. NCBI Accession No. NP_000881.3.
    Sequence:

    SYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEM KREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV


    Database link: P48544

  • Positive control

    • Human adrenal tissue; K562 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab219074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
  • Tissue specificity

    Islets, exocrine pancreas and heart.
  • Involvement in disease

    Defects in KCNJ5 are the cause of long QT syndrome type 13 (LQT13) [MIM:613485]. It is a heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ5 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiac ATP sensitive potassium channel antibody
    • Cardiac inward rectifier antibody
    • CIR antibody
    • G protein activated inward rectifier potassium channel 4 antibody
    • G protein-activated inward rectifier potassium channel 4 antibody
    • GIRK 4 antibody
    • GIRK-4 antibody
    • GIRK4 antibody
    • Heart KATP channel antibody
    • Inward rectifier K(+) channel Kir3.4 antibody
    • Inward rectifier K+ channel KIR3.4 antibody
    • Inward rectifier potassium channel KIR3.4 antibody
    • inwardly rectifying subfamily J member 5 antibody
    • IRK-4 antibody
    • IRK5_HUMAN antibody
    • KATP 1 antibody
    • KATP-1 antibody
    • KATP1 antibody
    • KCNJ 5 antibody
    • Kcnj5 antibody
    • KIR 3.4 antibody
    • KIR3.4 antibody
    • LQT13 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 5 antibody
    • Potassium inwardly rectifying channel J5 antibody
    • Potassium inwardly rectifying channel subfamily J member 5 antibody
    • potassium voltage-gated channel subfamily J member 5 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human adrenal tissue labeling KCNJ5 using ab219074 at 10 µg/ml.

  • Anti-KCNJ5 antibody [8D2] (ab219074) + K562 cell lysate

    Predicted band size: 48 kDa

References

ab219074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up