Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNJ5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human KCNJ5 aa 17-71.
    Sequence:

    VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGN VQETY


    Database link: P48544

  • Positive control

    • IHC: Human pancreas tissue. WB: KCNJ5 overexpression HEK-293T lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100. Predicted molecular weight: 48 kDa.

Target

  • Function

    This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
  • Tissue specificity

    Islets, exocrine pancreas and heart.
  • Involvement in disease

    Defects in KCNJ5 are the cause of long QT syndrome type 13 (LQT13) [MIM:613485]. It is a heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ5 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiac ATP sensitive potassium channel antibody
    • Cardiac inward rectifier antibody
    • CIR antibody
    • G protein activated inward rectifier potassium channel 4 antibody
    • G protein-activated inward rectifier potassium channel 4 antibody
    • GIRK 4 antibody
    • GIRK-4 antibody
    • GIRK4 antibody
    • Heart KATP channel antibody
    • Inward rectifier K(+) channel Kir3.4 antibody
    • Inward rectifier K+ channel KIR3.4 antibody
    • Inward rectifier potassium channel KIR3.4 antibody
    • inwardly rectifying subfamily J member 5 antibody
    • IRK-4 antibody
    • IRK5_HUMAN antibody
    • KATP 1 antibody
    • KATP-1 antibody
    • KATP1 antibody
    • KCNJ 5 antibody
    • Kcnj5 antibody
    • KIR 3.4 antibody
    • KIR3.4 antibody
    • LQT13 antibody
    • Potassium channel antibody
    • Potassium channel inwardly rectifying subfamily J member 5 antibody
    • Potassium inwardly rectifying channel J5 antibody
    • Potassium inwardly rectifying channel subfamily J member 5 antibody
    • potassium voltage-gated channel subfamily J member 5 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for KCNJ5 using ab224396 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-KCNJ5 antibody (ab224396) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate (negative control)
    Lane 2 : KCNJ5 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate

    Predicted band size: 48 kDa

References

ab224396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up