Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNK1/TWIK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human KCNK1/TWIK1 aa 281-335.
    Sequence:

    YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACV DGPAN


    Database link: O00180

  • Positive control

    • IHC: Human cerebellum tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as KCNK1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Weakly inward rectifying potassium channel.
  • Tissue specificity

    Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney.
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DPK antibody
    • HOHO antibody
    • HOHO1 antibody
    • inward rectifying potassium channel protein TWIK 1 antibody
    • Inward rectifying potassium channel protein TWIK-1 antibody
    • Inward rectifying potassium channel protein TWIK1 antibody
    • K2P1 antibody
    • K2p1.1 antibody
    • KCNK1 antibody
    • KCNK1_HUMAN antibody
    • KCNO1 antibody
    • OTTHUMP00000036029 antibody
    • Potassium channel KCNO1 antibody
    • Potassium channel subfamily K member 1 antibody
    • Potassium inwardly rectifying channel subfamily K member 1 antibody
    • TWIK 1 antibody
    • TWIK1 antibody
    see all

Images

  • Paraffin-embedded human cerebellum tissue stained for KCNK1/TWIK1 using ab224381 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for KCNK1/TWIK1 (green) using ab224381 at 4 µg/ml in ICC/IF.

References

ab224381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up