Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNK3/TASK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KCNK3/TASK1 aa 278-379.
    Sequence:

    SAHTTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPM IIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTG LH


    Database link: O14649

  • Positive control

    • IHC-P: Human pancreas and placenta tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as KCNK3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
  • Tissue specificity

    Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.
  • Involvement in disease

    Pulmonary hypertension, primary, 4
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acid sensitive potassium channel protein TASK 1 antibody
    • Acid sensitive potassium channel protein TASK antibody
    • Acid-sensitive potassium channel protein TASK-1 antibody
    • Cardiac two pore background K(+) channel antibody
    • cTBAK 1 antibody
    • K2p3.1 antibody
    • KCNK3 antibody
    • KCNK3_HUMAN antibody
    • OAT1 antibody
    • Potassium channel subfamily K member 3 antibody
    • potassium channel, subfamily K, member 3 antibody
    • Potassium inwardly rectifying channel subfamily K member 3 antibody
    • PPH4 antibody
    • rTASK antibody
    • TASK 1 antibody
    • TASK antibody
    • TBAK1 antibody
    • TWIK related acid sensitive K+ channel antibody
    • TWIK-related acid-sensitive K(+) channel 1 antibody
    • Two P domain potassium channel antibody
    • Two pore K(+) channel KT3. antibody
    • Two pore K(+) channel KT3.1 antibody
    • Two pore potassium channel KT3.1 antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for KCNK3/TASK1 (Green) using ab238588 at a 1/100 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • Paraffin-embedded human pancreas tissue stained for KCNK3/TASK1 with ab238588 at a 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human placenta tissue stained for KCNK3/TASK1 with ab238588 at a 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up