Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNK3/TASK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human KCNK3/TASK1 aa 325-374 (C terminal).
    Sequence:

    IPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSV

  • Positive control

    • Jurkat cell lysate
  • General notes

     This product was previously labelled as KCNK3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab49433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 38 kDa (predicted molecular weight: 43 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA: titre using peptide based assay: 1/1562500.

Target

  • Function

    pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
  • Tissue specificity

    Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.
  • Involvement in disease

    Pulmonary hypertension, primary, 4
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acid sensitive potassium channel protein TASK 1 antibody
    • Acid sensitive potassium channel protein TASK antibody
    • Acid-sensitive potassium channel protein TASK-1 antibody
    • Cardiac two pore background K(+) channel antibody
    • cTBAK 1 antibody
    • K2p3.1 antibody
    • KCNK3 antibody
    • KCNK3_HUMAN antibody
    • OAT1 antibody
    • Potassium channel subfamily K member 3 antibody
    • potassium channel, subfamily K, member 3 antibody
    • Potassium inwardly rectifying channel subfamily K member 3 antibody
    • PPH4 antibody
    • rTASK antibody
    • TASK 1 antibody
    • TASK antibody
    • TBAK1 antibody
    • TWIK related acid sensitive K+ channel antibody
    • TWIK-related acid-sensitive K(+) channel 1 antibody
    • Two P domain potassium channel antibody
    • Two pore K(+) channel KT3. antibody
    • Two pore K(+) channel KT3.1 antibody
    • Two pore potassium channel KT3.1 antibody
    see all

Images

  • Anti-KCNK3/TASK1 antibody (ab49433) at 1.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa
    Observed band size: 38 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Liu JJ  et al. MicroRNA-138 promotes proliferation and suppresses mitochondrial depolarization in human pulmonary artery smooth muscle cells through targeting TASK-1. Mol Med Rep 17:3021-3027 (2018). Read more (PubMed: 29257242) »
  • Antigny F  et al. Potassium Channel Subfamily K Member 3 (KCNK3) Contributes to the Development of Pulmonary Arterial Hypertension. Circulation 133:1371-85 (2016). Read more (PubMed: 26912814) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab49433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up