Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNMB4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human KCNMB4 aa 38-87.
    Sequence:

    CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV


    Database link: Q86W47

  • Positive control

    • ICC/IF: RT4 (human urinary bladder cancer cell line) cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
  • Tissue specificity

    Predominantly expressed in brain. In brain, it is expressed in the cerebellum, cerebral cortex, medulla, spinal cord, occipital pole, frontal lobe, temporal lobe, putamen, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Weakly or not expressed in other tissues.
  • Sequence similarities

    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB4 subfamily.
  • Domain

    Resistance to charybdotoxin (CTX) toxin is mediated by the extracellular domain.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation modulates its effect on KCNMA1 activation kinetics.
    N-glycosylated. A highly glycosylated form is promoted by KCNMA1. Glycosylation, which is not required for the interaction with KCNMA1 and subcellular location, increases protection against charybdotoxin.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BK channel subunit beta 4 antibody
    • BK channel subunit beta-4 antibody
    • BKbeta4 antibody
    • Calcium activated potassium channel beta 4 subunit antibody
    • Calcium activated potassium channel subfamily M subunit beta 4 antibody
    • Calcium activated potassium channel subunit beta 4 antibody
    • Calcium-activated potassium channel antibody
    • Calcium-activated potassium channel subunit beta-4 antibody
    • Charybdotoxin receptor subunit beta 4 antibody
    • Charybdotoxin receptor subunit beta-4 antibody
    • Hbeta4 antibody
    • K(VCA)beta 4 antibody
    • K(VCA)beta-4 antibody
    • KCMB4_HUMAN antibody
    • KCNMB 4 antibody
    • Kcnmb4 antibody
    • Large conductance calcium dependent potassium ion channel beta 4 subunit antibody
    • Maxi K channel subunit beta 4 antibody
    • Maxi K channel subunit beta-4 antibody
    • Potassium large conductance calcium activated channel subfamily M beta member 4 antibody
    • Slo beta 4 antibody
    • Slo-beta-4 antibody
    • subfamily M subunit beta-4 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for KCNMB4 (green) using ab222083 at 4 µg/ml in ICC/IF.

References

ab222083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up