Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNN2/SK2
  • Host species

    Rabbit
  • Specificity

    This antibody recognizes KCNN2/SK2.

  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Cow, Zebrafish
  • Immunogen

    Synthetic peptide within Human KCNN2/SK2 aa 443-492. The exact sequence is proprietary.
    Sequence:

    IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

  • Positive control

    • WB: HepG2 cell lysate.
  • General notes

    Protein previously known as KCNN2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab48817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay was 1:62500.

Target

Images

  • Anti-KCNN2/SK2 antibody (ab48817) at 1.25 µg/ml + HepG2 lysate at 10 µg with 5% skimmed milk in PBS.

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 64 kDa
    Observed band size: 70 kDa
    why is the actual band size different from the predicted?



    Gel concentration 12%

References

This product has been referenced in:

  • Kushwah N  et al. Hypobaric Hypoxia-Induced Learning and Memory Impairment: Elucidating the Role of Small Conductance Ca2+-Activated K+ Channels. Neuroscience 388:418-429 (2018). Read more (PubMed: 30048783) »
  • Willis M  et al. Small-conductance calcium-activated potassium type 2 channels (SK2, KCa2.2) in human brain. Brain Struct Funct 222:973-979 (2017). WB ; Human . Read more (PubMed: 27357310) »
See all 3 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (Whole heart lysate cleared by centrifuge)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
30 µg
Specification
Whole heart lysate cleared by centrifuge
Blocking step
Odyssey blocking buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Jun 08 2009

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up