Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNN2/SK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human KCNN2/SK2 aa 72-121 (internal sequence). The exact sequence is proprietary. Isoform b (NP_740721).
    Sequence:

    KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

  • Positive control

    • WB: Human fetal muscle, fetal heart and fetal lung tissue lysate. IF: Rhesus macaque spinal cord.
  • General notes

    Protein previously known as KCNN2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Western blot analysis of human fetal muscle tissue lysate labeling KCNN2/SK2 with ab85401 at 1.0µg/ml.

  • Western blot analysis of human fetal lung tissue lysate labeling KCNN2/SK2 with ab85401 at 1.0µg/ml.

  • Western blot analysis of human fetal heart tissue lysate labeling KCNN2/SK2 with ab85401 at 1.0µg/ml.

  • Anti-KCNN2/SK2 antibody (ab85401) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 26 kDa



    12% gel
  • ab85401 staining KCNN2/SK2 in rhesus macaque spinal cord by ICC/IF (Immunocytochemistry/immunofluorescence).  Samples were incubated with primary antibody (1/300). An Alexa Fluor®488-conjugated Donkey anti-rabbit (1/500) was used as the secondary antibody.

References

This product has been referenced in:

  • Willis M  et al. Small-conductance calcium-activated potassium type 2 channels (SK2, KCa2.2) in human brain. Brain Struct Funct 222:973-979 (2017). WB ; Human . Read more (PubMed: 27357310) »
  • Chakroborty S  et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer's disease mice. J Neurosci 32:8341-53 (2012). WB ; Mouse . Read more (PubMed: 22699914) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up