Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNN3/SK3
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous levels of KCNN3/SK3 protein.

  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human KCNN3/SK3 aa 1-736.
    Sequence:

    MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAA PQQPLGPSLQPQPPQLQQQQQQQQQQQQQQQQQQQPPHPLSQLAQLQSQP VHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDHLLGHSPSSTA TSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASR RNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQH AGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGI VVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLF VIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYT PSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINF NTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFL GAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARK LELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHA KVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITEL NDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEA RGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC


    Database link: Q9UGI6

  • General notes

    Protein previously labeled as KCNN3.

Properties

Applications

Our Abpromise guarantee covers the use of ab192515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 85 kDa.

Target

  • Function

    Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.
  • Sequence similarities

    Belongs to the potassium channel KCNN family. KCa2.3/KCNN3 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • hSK3 antibody
    • KCa2.3 antibody
    • Kcnn3 antibody
    • KCNN3_HUMAN antibody
    • Potassium calcium activated channel subfamily N member 3 antibody
    • Potassium channel calcium activated intermediate/small conductance subfamily N alpha member 3 antibody
    • Potassium channel, calcium activated, intermediate/small conductance, subfamily N, member 3 antibody
    • Potassium intermediate/small conductance calcium activated channel subfamily N member 3 antibody
    • SK3 antibody
    • SKCa 3 antibody
    • SKCa3 antibody
    • Small conductance calcium-activated potassium channel protein 3 antibody
    see all

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up