Overview

  • Product name

  • Description

    Mouse polyclonal to KCNN3/SK3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Pig
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human KCNN3/SK3 aa 301-410.
    Sequence:

    QAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQ IGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTT HTPISDSPIG


    Database link: Q9UGI6-2

  • Positive control

    • Y79 cell lysate and recombinant KCNN3/SK3 protein fragment.
  • General notes

    Protein previously labeled as KCNN3.

Properties

Applications

Our Abpromise guarantee covers the use of ab194347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 82 kDa.

Target

  • Function

    Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.
  • Sequence similarities

    Belongs to the potassium channel KCNN family. KCa2.3/KCNN3 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • hSK3 antibody
    • KCa2.3 antibody
    • Kcnn3 antibody
    • KCNN3_HUMAN antibody
    • Potassium calcium activated channel subfamily N member 3 antibody
    • Potassium channel calcium activated intermediate/small conductance subfamily N alpha member 3 antibody
    • Potassium channel, calcium activated, intermediate/small conductance, subfamily N, member 3 antibody
    • Potassium intermediate/small conductance calcium activated channel subfamily N member 3 antibody
    • SK3 antibody
    • SKCa 3 antibody
    • SKCa3 antibody
    • Small conductance calcium-activated potassium channel protein 3 antibody
    see all

Images

  • Anti-KCNN3/SK3 antibody (ab194347) at 1/500 dilution + Y79 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 82 kDa

  • Anti-KCNN3/SK3 antibody (ab194347) at 1/1000 dilution + Recombinant KCNN3/SK3 protein fragment at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 82 kDa

References

ab194347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up