Overview

  • Product name

  • Description

    Rabbit polyclonal to KCNN4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KCNN4 aa 301-360.
    Sequence:

    FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINA FRQVRLKHRK


    Database link: O15554

  • Positive control

    • IHC-P: Human smooth muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T cells. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin.
  • Tissue specificity

    Widely expressed in non-excitable tissues.
  • Sequence similarities

    Belongs to the potassium channel KCNN family. KCa3.1/KCNN4 subfamily.
  • Post-translational
    modifications

    Phosphorylation at His-358 by NDKB activates the channel, and conversely it's dephosphorylation by PHPT1 inhibits the channel.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHS2 antibody
    • hIKCa1 antibody
    • hKCa4 antibody
    • hSK4 antibody
    • IK antibody
    • IK1 antibody
    • IKCa1 antibody
    • Intermediate conductance calcium activated potassium channel protein 4 antibody
    • Intermediate conductance calcium-activated potassium channel protein 4 antibody
    • KCa3.1 antibody
    • KCa4 antibody
    • KCNN 4 antibody
    • Kcnn4 antibody
    • KCNN4_HUMAN antibody
    • Potassium calcium activated channel subfamily N member 4 antibody
    • Potassium intermediate/small conductance calcium activated channel, subfamily N, member 4 antibody
    • Putative Gardos channel antibody
    • SK4 antibody
    • SKCa 4 antibody
    • SKCa4 antibody
    see all

Images

  • Paraffin-embedded human smooth muscle tissue stained for KCNN4 using ab224581 at 1/500 dilution in immunohistochemical analysis.

References

ab224581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up