Overview

  • Product name

    Anti-KCNS3 antibody
  • Description

    Rabbit polyclonal to KCNS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human KCNS3 aa 1-180.
    Sequence:

    MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSE EAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFC QEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESS LFEKELEKFDTLRFGQLRKKIWIRMENPAY


    Database link: Q9BQ31

  • Positive control

    • WB: Mouse lung tissue lysate. IHC-P: Human lung tissue and gastric cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 56, 35 kDa (predicted molecular weight: 56 kDa).

Target

  • Function

    Potassium channel subunit. Modulates channel activity and reduces the ion flow.
  • Tissue specificity

    Detected in most tissues, but not in peripheral blood lymphocytes. The highest levels of expression are in lung.
  • Sequence similarities

    Belongs to the potassium channel family. S (TC 1.A.1.2) subfamily. Kv9.3/KCNS3 sub-subfamily.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization

    Cell membrane. May not reach the plasma membrane but remain in an intracellular compartment in the absence of KCNB1.
  • Information by UniProt
  • Database links

  • Alternative names

    • Delayed rectifier K(+) channel alpha subunit 3 antibody
    • Delayed rectifier K+ channel alpha subunit 3 antibody
    • Delayed-rectifier K(+) channel alpha subunit 3 antibody
    • KCNS 3 antibody
    • Kcns3 antibody
    • KCNS3_HUMAN antibody
    • KV 9.3 antibody
    • KV9.3 antibody
    • MGC9481 antibody
    • Potassium voltage gated channel delayed rectifier protein S3 antibody
    • Potassium voltage gated channel delayed rectifier subfamily S member 3 antibody
    • Potassium voltage gated channel subfamily S member 3 antibody
    • Potassium voltage-gated channel subfamily S member 3 antibody
    • Shab related delayed rectifier K+ channel alpha subunit 3 antibody
    • Voltage gated potassium channel subunit Kv9.3 antibody
    • Voltage-gated potassium channel subunit Kv9.3 antibody
    see all

Images

  • Anti-KCNS3 antibody (ab230343) at 1/1000 dilution + mouse lung tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 56 kDa
    Observed band size: 35,56 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lung tissue stained for KCNS3 with ab230343 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for KCNS3 with ab230343 at a 1/100 dilution in immunohistochemical analysis.

References

ab230343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up