Anti-KCNU1 antibody [N2/16] - C-terminal (ab94586)
Key features and details
- Mouse monoclonal [N2/16] to KCNU1 - C-terminal
- Suitable for: WB
- Reacts with: Rat
- Isotype: IgG2b
Overview
-
Product name
Anti-KCNU1 antibody [N2/16] - C-terminal -
Description
Mouse monoclonal [N2/16] to KCNU1 - C-terminal -
Host species
Mouse -
Tested Applications & Species
Application Species WB Rat -
Immunogen
Fusion protein corresponding to Mouse KCNU1 aa 1052-1121 (C terminal). AAB99742
Sequence:DSSPSIQAQNNSTNATTPLAQGSNFFDSHHADESHDLYPVDDTGERWSQH HHSRVYPLDTLDASDIVQEK
Database link: O54982 -
Positive control
- WB: Rat brain membrane lysate.
-
General notes
The clone number has been updated from S2-16 to N2/16, both clone numbers name the same antibody clone.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N2/16 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab94586 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
WB |
Rat
|
All applications |
Mouse
|
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 130 kDa.
|
Notes |
---|
WB
Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 130 kDa. |
Target
-
Function
Testis-specific potassium channel activated by both intracellular pH and membrane voltage that mediates export of K(+). May represent the primary spermatozoan K(+) current. In contrast to KCNMA1/SLO1, it is not activated by Ca(2+) or Mg(2+). Critical for fertility. May play an important role in sperm osmoregulation required for the acquisition of normal morphology and motility when faced with osmotic challenges, such as those experienced after mixing with seminal fluid and entry into the vagina. -
Tissue specificity
Testis-specific. -
Sequence similarities
Belongs to the potassium channel family. Calcium-activated (TC 1.A.1.3) subfamily. KCa5.1/KCNU1 sub-subfamily.
Contains 1 RCK N-terminal domain. -
Domain
The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium.
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel.
The C-terminal cytosolic region confers the pH-dependence. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 16532 Mouse
- Entrez Gene: 680912 Rat
- SwissProt: O54982 Mouse
- Unigene: 289679 Mouse
-
Alternative names
- subfamily M subunit alpha-3 antibody
- Calcium activated potassium channel subfamily M subunit alpha 3 antibody
- Calcium activated potassium channel subunit alpha 3 antibody
see all
Images
-
Anti-KCNU1 antibody [N2/16] - C-terminal (ab94586) at 1/1000 dilution + Rat brain membrane lysate at 15 µg
Secondary
Sheep Anti-Mouse IgG: HRP
Predicted band size: 130 kDaBlock: 1.5% BSA for 30 minutes at RT.
Primary antibody incubated for 2 hours at RT.
Secondary antibody incubated for 1 hour at RT.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab94586 has not yet been referenced specifically in any publications.