Overview

  • Product name

    Anti-KCNV2 antibody
  • Description

    Rabbit polyclonal to KCNV2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human KCNV2 aa 177-210 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    CPRRFLEELGYWGVRLKYTPRCCRICFEERRDEL


    Database link: Q8TDN2

  • Positive control

    • Human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potassium channel subunit. Modulates channel activity by shifting the threshold and the half-maximal activation to more negative values.
  • Tissue specificity

    Detected in lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary and colon.
  • Involvement in disease

    Defects in KCNV2 are the cause of cone dystrophy retinal type 3B (RCD3B) [MIM:610356]; also called cone dystrophy with night blindness and supernormal rod responses KCNV2-related. RCD3B is a rare form of cone dystrophy associated with supernormal rod responses. The disorder is characterized by reduced visual acuity, photoaversion, night blindness, and abnormal color vision. At an early age, the retina shows subtle depigmentation at the macula and, later, more obvious areas of atrophy.
  • Sequence similarities

    Belongs to the potassium channel family. V (TC 1.A.1.2) subfamily. Kv8.2/KCNV2 sub-subfamily.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization

    Cell membrane. Has to be associated with KCNB1 or possibly another partner to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB1.
  • Information by UniProt
  • Database links

  • Alternative names

    • KCNV2 antibody
    • KCNV2_HUMAN antibody
    • KV11.1 antibody
    • Kv8.2 antibody
    • MGC120515 antibody
    • Potassium channel subfamily V member 2 antibody
    • Potassium voltage-gated channel subfamily V member 2 antibody
    • RCD3B antibody
    • Voltage-gated potassium channel Kv8.2 antibody
    • Voltage-gated potassium channel subunit Kv8.2 antibody
    see all

Images

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded human colon carcinoma tissue labeling KCNV2 with ab214587 at 1/400 dilution, followed by secondary antibody detection and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6.0) for 15min; Block endogenous peroxidase by 3% hydrogen peroxide for 20 minutes; Blocking buffer (normal goat serum) at 37°C for 30min.

References

ab214587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up