Overview

  • Product name

    Anti-KCR1 antibody
  • Description

    Rabbit polyclonal to KCR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human KCR1 aa 104-153 (N terminal).
    Sequence:

    SVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTE


    Database link: NP_001013642

  • Positive control

    • Human Fetal Brain Lysate
  • General notes

     This product was previously labelled as ALG10B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab136669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa.

Target

  • Function

    Putative alpha-1,2-glucosyltransferase, which adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(2)Man(9)GlcNAc(2)-PP-Dol. When coupled to KCNH2 may reduce KCNH2 sensitivity to classic proarrhythmic drug blockade, possibly by mediating glycosylation of KCNH2.
  • Tissue specificity

    Highly expressed in heart, placenta, liver, kidney and pancreas. Weakly expressed in lung, skeletal muscle and brain.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the ALG10 glucosyltransferase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KCR1 antibody
    • 2-glucosyltransferase ALG10-A antibody
    • 2-glucosyltransferase antibody
    • AG10B_HUMAN antibody
    • Alg10b antibody
    • Alpha-1 antibody
    • Alpha-2-glucosyltransferase ALG10-B antibody
    • Asparagine-linked glycosylation protein 10 homolog B antibody
    • Potassium channel regulator 1 antibody
    • Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1 antibody
    see all

Images

  • Anti-KCR1 antibody (ab136669) at 1 µg/ml + Human Fetal Brain Lysate at 10 µg

    Predicted band size: 55 kDa

References

ab136669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up